General Information

  • ID:  hor000681
  • Uniprot ID:  P01258(85-116)
  • Protein name:  Calcitonin
  • Gene name:  CALCA
  • Organism:  Homo sapiens (Human)
  • Family:  Calcitonin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with CALCA include Reflex Sympathetic Dystrophy and Complex Regional Pain Syndrome.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0031716 calcitonin receptor binding; GO:0042802 identical protein binding
  • GO BP:  GO:0001503 ossification; GO:0001984 artery vasodilation involved in baroreceptor response to increased systemic arterial blood pressure; GO:0002548 monocyte chemotaxis; GO:0006874 intracellular calcium ion homeostasis; GO:0006939 smooth muscle contraction; GO:0006954 inflammatory response; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0007566 embryo implantation; GO:0007631 feeding behavior; GO:0009408 response to heat; GO:0030279 negative regulation of ossification; GO:0032147 activation of protein kinase activity; GO:0042311 vasodilation; GO:0045776 negative regulation of blood pressure; GO:0045779 negative regulation of bone resorption; GO:0045892 negative regulation of DNA-templated transcription; GO:0045986 negative regulation of smooth muscle contraction; GO:0048265 response to pain; GO:0050965 detection of temperature stimulus involved in sensory perception of pain; GO:0051480 regulation of cytosolic calcium ion concentration; GO:0071356 cellular response to tumor necrosis factor; GO:1990090 cellular response to nerve growth factor stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0030424 axon; GO:0043005 neuron projection; GO:0043025 neuronal cell body; GO:0043195 terminal bouton; GO:0098686 hippocampal mossy fiber to CA3 synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
  • Length:  32(85-116)
  • Propeptide:  MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN
  • Signal peptide:  MGFQKFSPFLALSILVLLQAGSLHA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.; Katacalcin is a potent plasma calcium-lowering peptide.
  • Mechanism:  [Isoform 2]: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
  • Cross BBB:  NA
  • Target:  RAMP1, CALCRL
  • Target Unid:  O60894, Q16602
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45664
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000681_AF2.pdbhor000681_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 397401 Formula: C151H227N39O46S3
Absent amino acids: ERW Common amino acids: T
pI: 7.25 Basic residues: 2
Polar residues: 15 Hydrophobic residues: 9
Hydrophobicity: 0.63 Boman Index: -1965
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 51.88
Instability Index: 3487.19 Extinction Coefficient cystines: 1615
Absorbance 280nm: 52.1

Literature

  • PubMed ID:  5760861
  • Title:  Human Calcitonin. Structure of Calcitonin M and D